PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g05330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 220aa    MW: 25621 Da    PI: 6.3066
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g05330genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.9e-1953106457
                 -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                 ++++++eq++ Le+ F  ++++  e++ +LA +lgL+ rqV vWFqNrRa++k+
  CA02g05330  53 KRKLSEEQVNLLEQSFGHEHKLESERKDKLALELGLDPRQVAVWFQNRRARWKN 106
                 45899***********************************************95 PP

2HD-ZIP_I/II115.43.3e-3752143293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +kr+ls+eqv+lLE+sF +e+kLe+erK +la eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+++++   +++rLe+ev +L+e+l+e
   CA02g05330  52 RKRKLSEEQVNLLEQSFGHEHKLESERKDKLALELGLDPRQVAVWFQNRRARWKNKKLEEEYSKLKNELETNIVDKCRLENEVLKLKEQLSE 143
                  8****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.82747107IPR001356Homeobox domain
SMARTSM003893.3E-1950111IPR001356Homeobox domain
CDDcd000868.85E-1752108No hitNo description
SuperFamilySSF466893.12E-1853116IPR009057Homeodomain-like
PfamPF000462.0E-1653106IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.3E-2054114IPR009057Homeodomain-like
PRINTSPR000312.3E-57887IPR000047Helix-turn-helix motif
PROSITE patternPS00027082105IPR017970Homeobox, conserved site
PRINTSPR000312.3E-587103IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MTSSMNDDQM PLISQYYPGI YTQPLPQQGE GKPRRRRKKN KDVANGEMMM MRKRKLSEEQ  60
VNLLEQSFGH EHKLESERKD KLALELGLDP RQVAVWFQNR RARWKNKKLE EEYSKLKNEL  120
ETNIVDKCRL ENEVLKLKEQ LSEAEKEMQR LQLERCDGIS SNSPTTSSLS MEAAMDPPFL  180
GEFGLDNAFY GPENTYYGPA NTYAQGLEWV NNLYMPYHM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13654RKKNKDVANGEMMMMRKRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754415e-87HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016558663.11e-163PREDICTED: homeobox-leucine zipper protein ATHB-40-like
SwissprotQ9ZU704e-74ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLM0ZZL21e-105M0ZZL2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000114641e-105(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12892480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.16e-69homeobox protein 40